Hostname: page-component-8448b6f56d-mp689 Total loading time: 0 Render date: 2024-04-19T19:34:37.368Z Has data issue: false hasContentIssue false
  • English
  • Français

Fertility of metapelites and metagraywackes during leucogranite generation: an example from the Black Hills, U.S.A.

Published online by Cambridge University Press:  03 November 2011

Peter I. Nabelek  and
Cindy D. Bartlett
Peter I. Nabelek
Affiliation:
Peter I. Nabelek and Cindy D. Bartlett, Department of Geological Sciences, University of Missouri-Columbia, Columbia, Missouri 65211,U.S.A.; e-mail: nabelekp@missouri.edu
Cindy D. Bartlett
Affiliation:
Peter I. Nabelek and Cindy D. Bartlett, Department of Geological Sciences, University of Missouri-Columbia, Columbia, Missouri 65211,U.S.A.; e-mail: nabelekp@missouri.edu
Get access Rights & Permissions [Opens in a new window]

Abstract

In order to elucidate how mineralogy and composition of crustal sources influences production of leucogranite magmas, we modelled the potential fertility of a sequence of metapelites and metagraywackes from the Black Hills, South Dakota, U.S.A., using a least-squares mixing approach. Rocks analogous to the Black Hills schists were the sources of the Harney Peak leucogranite. Both muscovite and biotite fluid-absent melting reactions (MM and BM, respectively) were investigated. Using the Harney Peak Granite composition as the melt analogue and mineral compositions from the schists for mixing calculations, it is shown that MM of metapelites would lead to highly variable residue mineralogy in the investigated samples. The average residue includes 36 wt.% biotite, 32 wt.% quartz, 12 wt.% plagioclase, 8 wt.% K-feldspar, 9 wt.% sillimanite and 2 wt.% garnet. Melt production ranges from 5% to 23% with an average of 14%. It is limited by the amount of H2O that must be in the melt at the conditions of melting, relative to the amount that is in muscovite in the source rocks. Plagioclase-rich metagraywackes contain little to no muscovite, thus MM cannot occur in them.

Although BM is continuous over a wide temperature range, for the purposes of modelling melting at 975°C and 10kbar was chosen. The temperature is near the terminal stability of biotite, thus the calculations give near-maximum melt production. At this temperature, the mineralogy of the model residues from both metapelites and metagraywackes is dominated by garnet. The potential melt production in the metapelites ranges from 0% to 58% with an average of 32%. It is limited by the availability of plagioclase in the source rocks. Potential melt production in the metagraywackes ranges from 9% to 37% with an average of 23%. At the chosen conditions of melting, melt production is limited by the available K in biotite, although at lower temperatures, the available H2O limits melt production. The total potential melt production (MM + BM) in the metapelites is higher because they have on average a low normative An/Ab ratio (0·14) that approaches the ratio in the leucogranites (0·04). The paragonite component in muscovite significantly contributes to the low ratio in the metapelites. The higher ration (0·27) in the metagraywackes is denned by the feldspar composition.

Using the calculated melt fractions and residue mineralogies, we modelled the concentrations of Rb, Sr and Ba in the melts, as these elements are important indicators of melt-generating processes. The results indicate that both Sr and Ba are likely to be heterogeneous in extracted melt batches and will be depleted in partial melts relative to their pelitic sources, irrespective of whether the melting is fluid-absent or fluid-present.

Keywords

fluid-absent meltingleucogranitesmetagraywackesmetapelitesU–Pb geochronology
Type
Research Article
Information
Earth and Environmental Science Transactions of The Royal Society of Edinburgh , Volume 91 , Issue 1-2: Fourth Hutton Symposium: The Origin of Granites and Related Rocks , 2000 , pp. 1 - 14
Copyright
Copyright © Royal Society of Edinburgh 2000

Access options

Get access to the full version of this content by using one of the access options below. (Log in options will check for institutional or personal access. Content may require purchase if you do not have access.)

References

Bryan, W. B., Finger, L. W.& Chayes, F. 1969. Estimating proportions in petrographic mixing equations by least-squares approximation. Science 163, 926–7.Google Scholar
Clemens, J. D.& Vielzeuf, D. 1987. Constraints on melting and magma production in the crust. Earth and Planetary Science Letters 86, 287–306.Google Scholar
Dahl, P. S., Holm, D. K., Gardner, E. T., Hubacher, F. A.& Foland, K. A. 1999. New constraints on the timing of Early Proterozoic tectonism in the Black Hills (South Dakota), with implications for docking of the Wyoming province with Laurentia. Geological Society of America Bulletin 111, 1335–49.Google Scholar
DeWitt, E., Redden, J. A., Buscher, D.& Burack-Wilson, A. 1989. Geologic map of the Black Hills area, South Dakota and Wyoming. U.S. Geological Survey.Google Scholar
Duke, E. F., Redden, J. A.& Papike, J. J. 1988. Calamity Peak layered granite-pegmatite complex, Black Hills, South Dakota: Part 1. Structure and emplacement. Bulletin of the Geological Society of America 100, 825–40.Google Scholar
Duke, E. F., Shearer, C. K., Redden, J. A.& Papike, J. J. 1990. Proterozoic granite-pegmatite magmatism, Black Hills, South Dakota: Structure and geochemical zonation. In Lewry, J. F.& Stauffer, M. R. (eds) The Early Proterozoic Trans-Hudson Orogen of North America, Geological Association of Canada Special Paper 37, 253–69.Google Scholar
Gardien, V., Thompson, A. B., Grujic, D.& Ulmer, P. 1995. Experimental melting of biotite + plagioclase + quartz muscovite assemblages and implications for crustal melting. Journal of Geophysical Research 100, 15,581–91.Google Scholar
Guillot, S.& Le Fort, P. 1995. Geochemical constraints on the bimodal origin of High Himalayan leucogranites. Lithos 35, 221–34.Google Scholar
Harris, N. B. W.& Inger, S. 1992. Trace element modelling of pelite-derived granites. Contributions to Mineralogy and Petrology 110, 46–56.Google Scholar
Holtz, F., Behrens, H.& Dingwell, D. B. 1995. Water solubility in haplogranite melts. American Mineralogist 80, 94–108.Google Scholar
Holtz, F.& Johannes, W. 1994. Maximum and minimum water contents of granitic melts: implications for chemical and physical properties of ascending magmas. Lithos 32, 149–59.Google Scholar
Icenhower, J.& London, D. 1995. An experimental study of element partitioning among biotite, muscovite, and coexisting peraluminous silicic melt at 200 MPa (H2O). American Mineralogist 80, 1229–51.Google Scholar
Icenhower, J.& London, D. 1996. Experimental partitioning of Rb, Cs, Sr, and Ba between alkali feldspar and peraluminous melt. American Mineralogist 81, 719–34.Google Scholar
Johannes, W.& Holtz, F. 1996. Petrogenesis and Experimental Petrology of Granitic rocks. Berlin: Springer.Google Scholar
Krogstad, E. J.& Walker, R. J. 1996. Evidence of heterogeneous crustal sources: the Harney Peak Granite, South Dakota, U.S.A. Transactions of the Royal Society of Edinburgh: Earth Sciences 87, 331–37.Google Scholar
Krogstad, E. J., Walker, R. J., Nabelek, P. I.& Russ-Nabelek, C. 1993. Lead isotopic evidence for mixed sources of Proterozoic granites and pegmatites, Black Hills, South Dakota, USA. Geochimica et Cosmochimica Acta 57, 4677–85.Google Scholar
Le Breton, N.& Thompson, A. B. 1988. Fluid-absent (dehydration) melting of biotite in metapelites in the early stages of crustal anatexis. Contributions to Mineralogy and Petrology 99, 226–37.Google Scholar
Le Fort, P., Cuney, M., Deniel, C., France-Lanord, C., Sheppard, S. M. F., Upreti, B. N.& Vidal, P. 1987. Crustal generation of the Himalayan leucogranites. Tectonophysics 134, 39–57.Google Scholar
Nabelek, P. I. 1999. Trace element distribution among rock-forming minerals in Black Hills migmatites, South Dakota: a case for solid-state equilibrium. American Mineralogist 84, 1256–69.Google Scholar
Nabelek, P. I.& Liu, M. 1999. Leucogranites in the Black Hills, South Dakota: The consequence of shear heating during continental collision. Geology 27, 523–6.Google Scholar
Nabelek, P. I., Russ-Nabelek, C.& Denison, J. R. 1992a. The generation and crystallization conditions of the Proterozoic Harney Peak leucogranite, Black Hills, South Dakota, USA: Petrologic and geochemical constraints. Contributions to Mineralogy and Petrology 110, 173–91.Google Scholar
Nabelek, P. I., Russ-Nabelek, C.& Haeussler, G. T. 1992b. Stable isotope evidence for the petrogenesis and fluid evolution in the Proterozoic Harney Peak leucogranite, Black Hills, South Dakota. Geochimica et Cosmochimica Acta 56, 403–17.Google Scholar
Nabelek, P. I., Sirbescu, M.& Liu, M. 1999. Petrogenesis and tectonic context of the Harney Peak Granite, Black Hills, South Dakota. Rocky Mountain Journal of Geology 34, 165–81.Google Scholar
Nabelek, P. I.& Bartlett, C. D. 1998. Petrologic and geochemical links between the post-collisional Proterozoic Harney Peak leucogranite, South Dakota, USA, and its source rocks. Lithos 45, 71–85.Google Scholar
Nash, W. P.& Crecraft, H. R. 1985. Partition coefficients for trace elements in silicic magmas. Geochimica et Cosmochimica Acta 49, 2309–22.Google Scholar
Patiño-Douce, A. E.& Beard, J. S. 1995. Dehydration-melting of biotite gneiss and quartz amphibolite from 3 to 15kbar. Journal of Petrology 36, 707–38.Google Scholar
Patiño-Douce, A. E.& Beard, J. S. 1996. Effects of P, f(O2) and Mg/Fe ratio on dehydration melting of model metagraywackes. Journal of Petrology 37, 999–1024.Google Scholar
Patiño-Douce, A. E.& Harris, N. 1998. Experimental constraints on Himalayan anatexis. Journal of Petrology 39, 689–710.Google Scholar
Patiño-Douce, A. E.& Johnston, A. D. 1991. Phase equilibria and melt productivity in the pelitic system: implications for the origin of peraluminous granitoids and aluminous granulites. Contributions to Mineralogy and Petrology 107, 202–18.Google Scholar
Petö, P. 1976. An experimental investigation of melting relations involving muscovite and paragonite in the silica-saturated portion of the system K2O-Na2O-Al2O3-SiO2-H2O to 15 kb total pressure. Progress in Experimental Petrology 3, 41–5.Google Scholar
Pickering, J. M.& Johnston, A. D. 1998. Fluid-absent melting behavior of two-mica metapelite: Experimental constraints on the origin of Black Hills granite. Journal of Petrology 39, 1787–804.Google Scholar
Pressley, R. A.& Brown, M. 1999. The Phillips Pluton, Maine, USA: Evidence of heterogeneous crustal sources, and implications for granite ascent and emplacement mechanisms in convergent orogens. Lithos 46, 335–66.Google Scholar
Redden, J. A., Peterman, Z. E., Zartman, R. E.& DeWitt, E. 1990. U–Th–Pb zircon and monazite ages and preliminary interpretation of the tectonic development of Precambrian rocks in the Black Hills. In Lewry, J. F.& Stauffer, M. R. (eds) The Early Proterozoic Trans- Hudson Orogen, Geological Association of Canada Special Paper 37, 229–51.Google Scholar
Scaillet, B., France-Lanord, C.& Fort, L P. 1990. Badrinath—Gangotri plutons (Garhwal, India): petrological and geochemical evidence for fractionation processes in high Himalayan leucogranite Journal of Volcanology and Geothermal Research 44, 163–88.Google Scholar
Skjerlie, K. P.& Johnston, A. D. 1993. Fluid-absent melting behavior of an F-rich tonalitic gneiss at mid-crustal pressures: Implications for the generation of anorogenic granites. Journal of Petrology 34, 785–815.Google Scholar
Stevens, G., Clemens, J. D.& Droop, G. T. R. 1997. Melt production during granulite-facies anatexis: experimental data from ‘primitive’ metasedimentary protoliths. Contributions to Mineralogy and Petrology 128, 352–70.Google Scholar
Thompson, A. B. 1996. Fertility of crustal rocks during anatexis. Transactions of the Royal Society of Edinburgh: Earth Sciences 87, 1–10.Google Scholar
Tomascak, P. B., Krogstad, E. J.& Walker, R. J. 1996. Nature of the crust in Maine, USA: evidence from the Sebago batholith. Contributions to Mineralogy and Petrology 125, 45–59.Google Scholar
Vielzeuf, D.& Holloway, J. R. 1988. Experimental determination of the fluid-absent melting relations in the pelitic system. Contributions to Mineralogy and Petrology 98 257–76.Google Scholar
Vielzeuf, D.& Kornprobst, J. 1984. Crustal splitting and the emplacement of Pyrenean lherzolites and granulites. Earth and Planetary Science Letters 67, 87–96.Google Scholar
Vielzeuf, D.& Montel, J. M. 1994. Partial melting of metagreywackes. Part 1. Fluid-absent experiments and phase relations. Contributions to Mineralogy and Petrology 117, 375–93.Google Scholar